General Information

  • ID:  hor006296
  • Uniprot ID:  Q7T3L1
  • Protein name:  Maximakinin
  • Gene name:  NA
  • Organism:  Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad)
  • Family:  Bradykinin-related peptide family
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0007165 signal transduction; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0042755 eating behavior; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DLPKINRKGPRPPGFSPFR
  • Length:  19
  • Propeptide:  MRLWFCLSFFIVLCLEHFTGTLADERNVPESEEKTEQFLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDMYEIKQYKTAHGRPPICAPGEQCPIWVGK
  • Signal peptide:  MRLWFCLSFFIVLCLEHFTGTLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Bombinakinin-GAP]: Plays a role in the control of feeding by the brain; intracerebroventricular administration of the peptide induced significant decrease in food intake in rats. Inhibits the bradykinin-induced in vitro relaxation of rat arterial smooth muscle. May target bradykinin receptors (BDKRB).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7T3L1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006296_AF2.pdbhor006296_ESM.pdb

Physical Information

Mass: 250077 Formula: C100H159N31O24
Absent amino acids: ACEHMQTVWY Common amino acids: P
pI: 12.24 Basic residues: 5
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -126.32 Boman Index: -5694
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 41.05
Instability Index: 6024.21 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12668203
  • Title:  Bombinakinin M gene associated peptide, a novel bioactive peptide from skin secretions of the toad Bombina maxima.
  • PubMed ID:  20138946
  • Title:  Peptide DV-28 amide: An inhibitor of bradykinin-induced arterial smooth muscle relaxation encoded by Bombina orientalis skin kininogen-2.